Neuropeptide Y (human, rat) trifluoroacetate salt,CAS : 90880-35-6
H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1093 | 0.5mg | 225.00 | + Add to cart |
|
R-M-1093 | 1mg | 400.00 | + Add to cart |
|
|
Product description
Neuropeptide Y (human, rat) trifluoroacetate salt,CAS : 90880-35-6 from ruixi. It can be applied to Obesitity, Parkinson disease research.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 90880-35-6 |
Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂ |
Synonyms | NPY (human, rat) |
Molecular Formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product